Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.42
PubTator Score 52.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 8 1 0.0 0.0
Disease Target Count
Fuchs Endothelial Dystrophy 5
Disease Target Count P-value
non-small cell lung carcinoma 317 4.4e-24
lung carcinoma 2843 1.2e-20
lung adenocarcinoma 2716 8.0e-08
diabetes mellitus 1728 1.4e-02
psoriasis 6694 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.4
Vascular disease 319 0.0 3.0
Disease Target Count Z-score Confidence
Bullous keratopathy 7 3.72 1.9
Disease Target Count
Fuchs' endothelial dystrophy 24

Gene RIF (2)

AA Sequence

MISKGGSEALLQTLVDTARTAPPDYDILLPLFRLLAKVGLRDKKIGRKALELEALDVTLILARKNLSHGQ      1 - 70
NLLHCLWALRVFASSVSMGAMLGINGAMELLFKVITPYTRKRTQAIRAATEVLAALLKSKSNGRRAVNRG     71 - 140
YVTSLLGLHQDWHSHDTANAYVQIRRGLLLCLRHIAALRSGREAFLAAQGMEILFSTTQNCLDDKSMEPV    141 - 210
ISVVLQILRQCYPTSPLPLVTASSAYAFPVPGCITTEPPHDLPEEDFEDDGDDEVDKDSDTEDGKVEDDD    211 - 280
LETDVNKLSSKPGLDRPEEELMQYEVMCLELSYSFEELQSKLGDDLNSEKTQYANHHHIPAAASSKQHCY    281 - 350
SKDQSSCGQEREYAVQTSLLCRVKTGRSTVHLGSKKNPGVNLYQNVQSNSLRRDSSESEIPDIQASPKAD    351 - 420
AWDVDAIFCPRMSASFSNSTRTREVVKVIDKLLQTHLKRVPFHDPYLYMAKARRTSSVVDFKMMAFPDVW    421 - 490
GHCPPPTTQPMLERKCGVQRIRIFEDIRRLIQPSDVINKVVFSLDEPWPLQDNASNCLRFFSKFESGNLR    491 - 560
KAIQVREFEYDLLVNADVNSTQHQQWFYFKVSGMQAAIPYHFNIINCEKPNSQFNYGMQPTLYSVKEALL    561 - 630
GKPTWIRTGHEICYYKNHYRQSTAVAGGASGKCYYTLTFAVTFPHSEDVCYLAYHYPYTYTALMTHLDIL    631 - 700
EKSVNLKEVYFRQDVLCQTLGGNPCPLVTITAMPESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKG    701 - 770
TLEFLVSSDPVARLLRENFIFKIIPMLNPDGVINGNHRCSLSGEDLNRQWLSPSAHLQPTIYHAKGLLYH    771 - 840
LSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILDKLAPAFTMSS    841 - 910
CSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQCTQRLLERTKNERAHPVDGLQGLQFGTR    911 - 980
ELEEMGAMFCLGLLILELKSASCSHQLLAQAATLLSAEEDALDQHLQRLKSSNFLPKHIWFAYHFFAITN    981 - 1050
FFKMNLLLHVSPVCDT                                                         1051 - 1066
//

Text Mined References (19)

PMID Year Title