Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.37
PubTator Score 52.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.500 0.014
lung adenocarcinoma -2.200 0.000
lung carcinoma -3.100 0.000
non-small cell lung carcinoma -2.100 0.000
psoriasis -1.100 0.048

Synonym

Accession Q96MI9 A1A4X5 A6NJH6 C9JHL5
Symbols CCP4
FECD8

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24094747 That AGBL1 interacts biochemically with the FCD-associated protein TCF4.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MISKGGSEALLQTLVDTARTAPPDYDILLPLFRLLAKVGLRDKKIGRKALELEALDVTLILARKNLSHGQ      1 - 70
NLLHCLWALRVFASSVSMGAMLGINGAMELLFKVITPYTRKRTQAIRAATEVLAALLKSKSNGRRAVNRG     71 - 140
YVTSLLGLHQDWHSHDTANAYVQIRRGLLLCLRHIAALRSGREAFLAAQGMEILFSTTQNCLDDKSMEPV    141 - 210
ISVVLQILRQCYPTSPLPLVTASSAYAFPVPGCITTEPPHDLPEEDFEDDGDDEVDKDSDTEDGKVEDDD    211 - 280
LETDVNKLSSKPGLDRPEEELMQYEVMCLELSYSFEELQSKLGDDLNSEKTQYANHHHIPAAASSKQHCY    281 - 350
SKDQSSCGQEREYAVQTSLLCRVKTGRSTVHLGSKKNPGVNLYQNVQSNSLRRDSSESEIPDIQASPKAD    351 - 420
AWDVDAIFCPRMSASFSNSTRTREVVKVIDKLLQTHLKRVPFHDPYLYMAKARRTSSVVDFKMMAFPDVW    421 - 490
GHCPPPTTQPMLERKCGVQRIRIFEDIRRLIQPSDVINKVVFSLDEPWPLQDNASNCLRFFSKFESGNLR    491 - 560
KAIQVREFEYDLLVNADVNSTQHQQWFYFKVSGMQAAIPYHFNIINCEKPNSQFNYGMQPTLYSVKEALL    561 - 630
GKPTWIRTGHEICYYKNHYRQSTAVAGGASGKCYYTLTFAVTFPHSEDVCYLAYHYPYTYTALMTHLDIL    631 - 700
EKSVNLKEVYFRQDVLCQTLGGNPCPLVTITAMPESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKG    701 - 770
TLEFLVSSDPVARLLRENFIFKIIPMLNPDGVINGNHRCSLSGEDLNRQWLSPSAHLQPTIYHAKGLLYH    771 - 840
LSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILDKLAPAFTMSS    841 - 910
CSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQCTQRLLERTKNERAHPVDGLQGLQFGTR    911 - 980
ELEEMGAMFCLGLLILELKSASCSHQLLAQAATLLSAEEDALDQHLQRLKSSNFLPKHIWFAYHFFAITN    981 - 1050
FFKMNLLLHVSPVCDT                                                         1051 - 1066
//

Text Mined References (19)

PMID Year Title
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24094747 2013 Mutations in AGBL1 cause dominant late-onset Fuchs corneal dystrophy and alter protein-protein interaction with TCF4.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23594818 2013 Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
22961001 2012 Common variants at the MHC locus and at chromosome 16q24.1 predispose to Barrett's esophagus.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21993531 2012 Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response.
21448238 2011 Meta-analysis of genome-wide association for migraine in six population-based European cohorts.
More...