Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.00
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.6e-20
tuberculosis 2010 2.2e-07
osteosarcoma 7950 5.0e-05
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 3.0
Disease Target Count Z-score Confidence
Polycystic kidney disease 1 21 3.318 1.7
Herpes simplex 18 3.296 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer -1.289 1.6e-20
osteosarcoma -1.881 5.0e-05
tuberculosis 1.200 2.2e-07

Gene RIF (1)

AA Sequence

MHLNGRCICPSDPQFVEEKGIRAEDLVIGALESAFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMA      1 - 70
NAGDSRAILVRRDEIRPLSFEFTPETERQRIQQLAFVYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHH     71 - 140
MSGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVDQL    141 - 210
ELQEDDVVVMATDGLWDVLSNEQVAWLVRSFLPGNQEDPHRYCSCWGPAWAWVGASSKPK              211 - 270
//

Text Mined References (9)

PMID Year Title