Property Summary

NCBI Gene PubMed Count 9
Grant Count 13
R01 Count 10
Funding $1,123,242.35
PubMed Score 4.00
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.881 0.000
tuberculosis 1.200 0.000
non-small cell lung cancer -1.289 0.000

Gene RIF (1)

PMID Text
19594441 PP2Ceta-2 inhibits the IL-1-NF-kappaB signalling pathway by selectively dephosphorylating IKKbeta.

AA Sequence

MHLNGRCICPSDPQFVEEKGIRAEDLVIGALESAFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMA      1 - 70
NAGDSRAILVRRDEIRPLSFEFTPETERQRIQQLAFVYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHH     71 - 140
MSGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVDQL    141 - 210
ELQEDDVVVMATDGLWDVLSNEQVAWLVRSFLPGNQEDPHRYCSCWGPAWAWVGASSKPK              211 - 270
//

Text Mined References (9)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22182935 2013 Genome-wide association study meta-analysis of European and Asian-ancestry samples identifies three novel loci associated with bipolar disorder.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
19594441 2009 A mechanism for the suppression of interleukin-1-induced nuclear factor kappaB activation by protein phosphatase 2Ceta-2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654243 2003 Molecular cloning of PP2Ceta, a novel member of the protein phosphatase 2C family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.