Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 3.1e-07
adrenocortical carcinoma 1428 1.3e-04
group 3 medulloblastoma 4104 5.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma 1.677 1.3e-04
group 3 medulloblastoma 1.200 5.0e-03
tuberculosis -1.700 3.1e-07

AA Sequence

MAAELRMILYEDDSVQVQYVDGSTLQLSPCGTEFLFEKSPPVSAHPLEQPERIRQRTHFVISTYREQLQR      1 - 70
ALDFRNSSATCPFLSETIIPSERKKHIFIDITEVRWPSLDTDGTMIYMESGIVKITSLDGHAYLCLPRSQ     71 - 140
HEFTVHFLCKVSQKSDSSAVLSETNNKAPKDKLVEKTGKICIRGNLPGQRLKNKENEFHCQIMKSKETLK    141 - 210
KMSCVNGTEGREELPSPGTKHTCVYTWVKQCWSVAACPEEWKYPLSLALHFHNKISNMSKIDAHITQSRF    211 - 280
LTSDISEERGKVVSVLPRALSLSCPVPHLHRWNFCDSLLQRQSDEYSYPELVKMVWYKGVTYRLTHQNMN    281 - 350
SIEIYSGDGSVFKSEGAYFGNYFTYYSIQEGSGKREEKTYSVNNLPPDRPGSPFTVGSLIKQATRILQHC    351 - 420
VKMRLSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSP    421 - 490
IEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEPYERYVTTVTSWCRRLTQTSPREMPTHSSSSVLQENW    491 - 560
SVASELEKIQKFNLLLENSGILNQISNKKNEQQSFDHYKPGSSETLLGEVNENRVSIALKKTSEILHDID    561 - 630
CLLSNSKK                                                                  631 - 638
//

Text Mined References (5)

PMID Year Title