Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma 1.677 0.000
tuberculosis -1.700 0.000
sonic hedgehog group medulloblastoma 1.400 0.001

Synonym

Accession Q96MH7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAAELRMILYEDDSVQVQYVDGSTLQLSPCGTEFLFEKSPPVSAHPLEQPERIRQRTHFVISTYREQLQR      1 - 70
ALDFRNSSATCPFLSETIIPSERKKHIFIDITEVRWPSLDTDGTMIYMESGIVKITSLDGHAYLCLPRSQ     71 - 140
HEFTVHFLCKVSQKSDSSAVLSETNNKAPKDKLVEKTGKICIRGNLPGQRLKNKENEFHCQIMKSKETLK    141 - 210
KMSCVNGTEGREELPSPGTKHTCVYTWVKQCWSVAACPEEWKYPLSLALHFHNKISNMSKIDAHITQSRF    211 - 280
LTSDISEERGKVVSVLPRALSLSCPVPHLHRWNFCDSLLQRQSDEYSYPELVKMVWYKGVTYRLTHQNMN    281 - 350
SIEIYSGDGSVFKSEGAYFGNYFTYYSIQEGSGKREEKTYSVNNLPPDRPGSPFTVGSLIKQATRILQHC    351 - 420
VKMRLSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSP    421 - 490
IEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEPYERYVTTVTSWCRRLTQTSPREMPTHSSSSVLQENW    491 - 560
SVASELEKIQKFNLLLENSGILNQISNKKNEQQSFDHYKPGSSETLLGEVNENRVSIALKKTSEILHDID    561 - 630
CLLSNSKK                                                                  631 - 638
//

Text Mined References (5)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.