Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.88788047221851E-10
atypical teratoid / rhabdoid tumor 4369 9.42833594581053E-8
pediatric high grade glioma 2712 3.59122177253581E-6
glioblastoma 5572 3.33535164181913E-5
hepatocellular carcinoma 550 3.78902971987043E-5
group 3 medulloblastoma 2254 6.83863306224405E-5
interstitial cystitis 2299 1.28206307532022E-4
medulloblastoma, large-cell 6234 2.5017129562934E-4
primitive neuroectodermal tumor 3031 6.2279327910849E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00709959158742391
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0236726252506372
osteosarcoma 7933 0.0452141179373423
chronic rhinosinusitis 512 0.0465933496916524

Expression

Synonym

Accession Q96MH6 Q658X6 Q8WUD2
Symbols

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFTIFLLYLTIIF      1 - 70
LHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPEDGPALIIFYHGAIPIDFYYF     71 - 140
MAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEILRSGHLLAISPGGVREALISDETY    141 - 210
NIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSLGGTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGD    211 - 280
PIPYDPQITAEELAEKTKNAVQALIDKHQRIPGNIMSALLERFH                              281 - 324
//

Text Mined References (8)

PMID Year Title
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.