Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.68
PubTator Score 5.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 9.2e-07
group 3 medulloblastoma 4002 1.2e-02

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.2e-02
osteosarcoma -1.593 9.2e-07

Gene RIF (10)

AA Sequence

MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSR      1 - 70
SPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAP     71 - 140
YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSK    141 - 210
QELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRC    211 - 280
DEEPGT                                                                    281 - 286
//

Text Mined References (28)

PMID Year Title