Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.59
PubTator Score 4.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.200 6.0e-06
osteosarcoma -1.679 3.2e-04
ovarian cancer -1.100 2.7e-03
progressive supranuclear palsy -1.200 2.3e-02
psoriasis -1.100 1.2e-11
urothelial carcinoma -1.100 1.2e-03

Gene RIF (5)

AA Sequence

MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGNIHLSAPCIYS      1 - 70
EVMEALKLQPGLSFLNLGSGTGYLSTMVGLILGPFGINHGIELHSDVVEYAKEKLESFIKNSDSFDKFEF     71 - 140
CEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMPIEDQLTQIMRTGQNTWESKN    141 - 210
ILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKR    211 - 280
VKQRINTYVFVGNQLIPQPLDSEEDEKMEEDNKEEEEKDHNEAMKPEEPPQNLLREKIMKLPLPESLKAY    281 - 350
LTYFRDK                                                                   351 - 357
//

Text Mined References (12)

PMID Year Title