Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.51
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 0.000

Synonym

Accession Q96MG7 Q8IW16 Q8TEI6 Q9H214 Non-SMC element 3 homolog
Symbols HCA4
NSE3
NDNL2
MAGEG1
MAGEL3

Gene

PANTHER Protein Class (1)

PDB

3NW0  

Gene RIF (2)

PMID Text
18086888 The four non-SMC components of the human complex were identified and characterized and it was demonstrated that the MAGEG1 protein is part of this complex.
11782285 gene expression, imprinting, and chromosome mapping of NDNL2

AA Sequence

MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARR      1 - 70
AQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGY     71 - 140
KLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPT    141 - 210
KKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPA    211 - 280
QYCEALADEENRARPQPSGPAPSS                                                  281 - 304
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
21269460 2011 Initial characterization of the human central proteome.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18086888 2008 Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex.
15635413 2005 Nucleolar proteome dynamics.
More...