Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.92
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.8e-06
Disease Target Count Z-score Confidence
Viral pneumonia 5 3.269 1.6
Prader-Willi syndrome 48 3.268 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 4.8e-06

Gene RIF (3)

AA Sequence

MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARR      1 - 70
AQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGY     71 - 140
KLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPT    141 - 210
KKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPA    211 - 280
QYCEALADEENRARPQPSGPAPSS                                                  281 - 304
//

Text Mined References (16)

PMID Year Title