Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.74
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count Z-score Confidence
Malignant hyperthermia 26 3.716 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 8.8e-03
glioblastoma -1.200 4.2e-05
lung adenocarcinoma 1.400 1.6e-04
medulloblastoma, large-cell -1.100 7.7e-03
non primary Sjogren syndrome sicca 1.200 1.5e-02
osteosarcoma -1.080 1.6e-05
ovarian cancer -1.200 8.3e-06
spina bifida 1.274 3.7e-02

Synonym

Accession Q96MG2
Symbols JP45
JP-45

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEP      1 - 70
AARGTPGTGKERLKAGASPRSVPARKKAQTAPPLQPPPPPPALSEELPWGDLSLNKCLVLASLVALLGSA     71 - 140
FQLCRDAVPGEAALQARVPEPWVPPSSAPREPSSPLPKFEAQAPPSAPPAPRAEAEVRPKIPGSREAAEN    141 - 210
DEEEPGEATGEAVREDRVTLADRGPKERPRREGKPRKEKPRKEERPKKERPRKEERPRAAREPREALPQR    211 - 280
WESREGGHRPWARDSRDAEPRKKQAWVSPRRPDEEQRPGSRQKLRAGKGRD                       281 - 331
//

Text Mined References (8)

PMID Year Title