Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $288,525
PubMed Score 8.74
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.080 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.100 0.008
adult high grade glioma -1.200 0.009
non primary Sjogren syndrome sicca 1.200 0.015
lung adenocarcinoma 1.400 0.000
spina bifida 1.274 0.037
ovarian cancer -1.200 0.000

Synonym

Accession Q96MG2
Symbols JP45
JP-45

Gene

Gene RIF (3)

PMID Text
22927026 Data indicate that the presence of either one of these JP-45 variants decreased the sensitivity of the dihydropyridine receptor DHPR to activation.
20442750 Observational study of gene-disease association. (HuGE Navigator)
16423849 The results may be explained by a modulatory effect of JP-45 related to its reported in vitro interaction with the dihydropyridine receptor and the SR Ca(2+) binding protein calsequestrin (CSQ).

AA Sequence

MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEP      1 - 70
AARGTPGTGKERLKAGASPRSVPARKKAQTAPPLQPPPPPPALSEELPWGDLSLNKCLVLASLVALLGSA     71 - 140
FQLCRDAVPGEAALQARVPEPWVPPSSAPREPSSPLPKFEAQAPPSAPPAPRAEAEVRPKIPGSREAAEN    141 - 210
DEEEPGEATGEAVREDRVTLADRGPKERPRREGKPRKEKPRKEERPKKERPRKEERPRAAREPREALPQR    211 - 280
WESREGGHRPWARDSRDAEPRKKQAWVSPRRPDEEQRPGSRQKLRAGKGRD                       281 - 331
//

Text Mined References (8)

PMID Year Title
22927026 2013 JP-45/JSRP1 variants affect skeletal muscle excitation-contraction coupling by decreasing the sensitivity of the dihydropyridine receptor.
20442750 2010 Follow-up of potential novel Graves' disease susceptibility loci, identified in the UK WTCCC genome-wide nonsynonymous SNP study.
16423849 2006 A possible role of the junctional face protein JP-45 in modulating Ca2+ release in skeletal muscle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12871958 2003 The novel skeletal muscle sarcoplasmic reticulum JP-45 protein. Molecular cloning, tissue distribution, developmental expression, and interaction with alpha 1.1 subunit of the voltage-gated calcium channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.