Property Summary

NCBI Gene PubMed Count 29
PubMed Score 25.70
PubTator Score 12.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.700 2.9e-02
diabetes mellitus -1.300 1.2e-03
group 3 medulloblastoma 1.100 3.1e-04

Gene RIF (11)

AA Sequence

MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFAT      1 - 70
LDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQC     71 - 140
GLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYC    141 - 210
PQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE                                     211 - 247
//

Text Mined References (36)

PMID Year Title