Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ovarian cancer 8,484
psoriasis 6,685

Synonym

Accession Q96MF4
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNRWRRQSCQGPS      1 - 70
PARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEA     71 - 140
EEMKKKKERKRRKERKKERNFKK                                                   141 - 163
//

Text Mined References (7)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760737 2004 Coiled coil domains: stability, specificity, and biological implications.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11166216 2001 Coiled coils: a highly versatile protein folding motif.
9138288 1997 Alpha-helical coiled-coil oligomerization domains in extracellular proteins.