Property Summary

NCBI Gene PubMed Count 13
PubMed Score 551.07
PubTator Score 667.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis 1.100 4.5e-08

 GO Component (2)

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MTEKEVLESPKPSFPAETRQSGLQRLKQLLRKGSTGTKEMELPPEPQANGEAVGAGGGPIYYIYEEEEEE      1 - 70
EEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRC     71 - 140
FGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFETLRTGVIMANKERKKGQADKKNPVAAMMEEE    141 - 210
PESARPEEGKPQDGNPEGDKKAEKKTPDDKHKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDS    211 - 280
NEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTG    281 - 350
RKVGLFPTDFLEEI                                                            351 - 364
//

Text Mined References (14)

PMID Year Title