Knowledge Summary

Patent

No data available

Synonym

Accession Q96MF0 B2RPC9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPFKTKYPNGFHFAYLPTGSTQFRSLLQGQDSASQGVCPCRLCGAVPVRDQARIQSRRITLANCQGQPSA      1 - 70
LRQVNELANSAQIESFLCFSQLPNAVCFGGHLSCEFRECGYCNINPHHSKQLKLNSVTREES             71 - 132
//

Text Mined References (3)

PMID Year Title