Knowledge Summary

Patent

No data available

Synonym

Accession Q96MF0 B2RPC9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPFKTKYPNGFHFAYLPTGSTQFRSLLQGQDSASQGVCPCRLCGAVPVRDQARIQSRRITLANCQGQPSA      1 - 70
LRQVNELANSAQIESFLCFSQLPNAVCFGGHLSCEFRECGYCNINPHHSKQLKLNSVTREES             71 - 132
//

Text Mined References (3)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.