Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.93
PubTator Score 0.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 9.8e-10
osteosarcoma 7950 8.2e-09
sonic hedgehog group medulloblastoma 467 9.1e-05
progressive supranuclear palsy 676 5.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Baraitser-Winter syndrome 12 4.723 2.4
Microcephaly 166 3.063 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 9.8e-10
osteosarcoma 2.067 8.2e-09
progressive supranuclear palsy 1.200 5.8e-03
sonic hedgehog group medulloblastoma -1.400 9.1e-05

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIH      1 - 70
TVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKML     71 - 140
SALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREG    141 - 210
AILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATK    211 - 280
NLLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNL    281 - 350
SGCVHCLSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLARLRHLRSLSL    351 - 420
PVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQSCPSPFSGQACPQPSSVFWSLLKNLPFLEHLEL    421 - 490
IGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGLVNIGLQCQQL    491 - 560
RSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQP    561 - 630
DAVLAFMARCLQVVMCHLFTGESLATCKSLQQSLLRRWGEVTGRRPQLFTELREEPSARTSRATGRRQPC    631 - 700
LPDSGVVCCPCGRPLAVSGIILVGVSPSLVVKTTCVYRVLFKNLDYASIFFLVCLFETESHSVVQAGVQW    701 - 770
RDLSSLQPLLSGLQPQPPEQLENELEIGFSYCFVI                                       771 - 805
//

Text Mined References (10)

PMID Year Title