Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 467 2.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 2.1e-03

Synonym

Accession Q96MD7 Q5W0N1 Q5W0N3 Q6PJW9 Q86U95
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKC      1 - 70
VKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPWSLPLLPRLECSGRILAHHNLRLPCSSDSPAS     71 - 140
ASRVAGTTGAHHHAQLIFVFLVEMGFHYVGQAGLELLTS                                   141 - 179
//

Text Mined References (9)

PMID Year Title