Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
non-small cell lung cancer 2798 1.11583786761129E-16
interstitial cystitis 2299 8.18711063514878E-5
medulloblastoma, large-cell 6234 6.50786340967673E-4
osteosarcoma 7933 6.52355005335043E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00482877037048204
invasive ductal carcinoma 2950 0.0118198176325079
group 4 medulloblastoma 1875 0.0173753810231336
Breast cancer 3099 0.0260219833290876
Rheumatoid Arthritis 1171 0.0371643955973882

Expression

  Differential Expression (9)

Synonym

Accession Q96MD2 C9JX54 Q8IYA0
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

AA Sequence

MGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANKSAGGSWLSLLAALAHLAAAEKVYHS      1 - 70
LTYLGQKLGGQSFFSRKDSIRTIYTSLHNELKKVVTGRGALGGTAPHVEELLSHLSEQLCFFVQARMEMA     71 - 140
DFYEKMYTLSTQKFINAEELVGLLDAIMKKYSSRFHHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFL    141 - 210
PSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQ    211 - 280
TTASEMKTLTAKANPDFFGKISSFIRKYDAANVSLIFDNRGSESFQGHGYHHPHSYREAPKGVDQYPAVV    281 - 350
SLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDKVQSTYFLTRPEPHFTIVIIFESKKSERDSHFI    351 - 420
SFLNEVSLALKNPKVFASLKPGAKG                                                 421 - 445
//

Text Mined References (6)

PMID Year Title
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.