Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Connective tissue disease 59 1.0

Expression

AA Sequence

MCSGWSSSVIWRHTQFAVERCGFCGSSGPGAPLEPSTLGSKHLPWEAVSAGFADRNRNMDGAMWLSLCPD      1 - 70
NEDLLWRKKHKLLQARGKGDLALQRRADAKLWKNYQLQRLAEELRRGYQEAQHLHVGGLDRLQSARLLGW     71 - 140
GGGRARENEPDSQGPIQRRSARPPRAKEKHRAALSEERSCREELGQQHPRHSRPRKTAASPEKPQTTKAT    141 - 210
GRMNSHLAPPEKRKGRPEPSTKSGGGRCAIHPRRSKGADLERSNPLVAAVGEIGLVEEKEKGTARAGRRQ    211 - 280
LGKGAVCFVPALTSRSQGQSLEGKLRDLGQLWPADSSCRREAVSPASQCTLREKNKWQKELELAFEELFN    281 - 350
INRKLKKHLCLYLALKPRMDQRPGEGHAFSEMQECGAGTPRGKKMADPEMLPAGEPRSPAEEEAQQAASK    351 - 420
TDLKTFMGKAQNQKYQGTVKPTFRNGSQTLSPEAGIFINKEDSLLYSTESGQETPKLGTLAEGSLQLHLQ    421 - 490
DQADRVGSTASRQRQKAEMEQRRQKQLESLEQMEHPDMSLEIHYKAELEKERREQRRARLAHLKSSSTRA    491 - 560
QERERGSELSTTSPSGTSLADDDRHSQMIRDQQQQILQQNRLHKQFLEEARKCLREFQNIC             561 - 621
//

Text Mined References (4)

PMID Year Title
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.