Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $105,523.25
PubMed Score 0.77
PubTator Score 33.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q96MC2 A8K1N8 Q53R91 Q53TA3 Q8NDI5
Symbols CILD21
C2orf39
CCDC164

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
23354437 Loss-of-function mutations disrupting DRC1 result in severe defects in assembly of the N-DRC structure and defective ciliary movement in Chlamydomonas reinhardtii and humans

AA Sequence

MNPPGSLEALDPNVDEHLSTQILAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQS      1 - 70
KSYKQKEESRLKLAKLLLCGTELVTNIQVAIDIREIHRRVEEEEIKRQRIEKLENEVKTSQDKFDEITSK     71 - 140
WEEGKQKRIPQELWEMLNTQQLHCAGLLEDKNKLISELQQELKTKDDQYVKDLKKQSDDICLLLERMEEQ    141 - 210
VKNVMKTFREELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWD    211 - 280
CEEYNMIKIKLEQDVQILEQQLQQRKAIYQLNQEKLEYNLQVLKKRDEESTVIKSQQKRKINRLHDILNN    281 - 350
LRSKYAKQIKQFQEENQSLTSDYKRLVMQFKELQKAMRHFALIDDEKFWEIWLMNEEEAKDLIARAFDVD    351 - 420
RIIHTHHLGLPWAAPDFWFLNNVGPISQQPQKSATQIVEEMLMRSEEEEAEEAAAEPESYLDLPKQISEK    421 - 490
TTKRILMLLCDESGFLIESKLLSLLLPLEQNECYLLRLDAIFSALGIESEDDLYKLVNFFLKYRAHRLSS    491 - 560
SLQIKPCSQASMEKASMEETSTRSELELAEQTEMEGEKEESLVEGEKEEEEETPPSPWVIHPNDVLKILE    561 - 630
AFVMGLKKPRDSRAPLRVQKNVRDNSKDSEYWQALTTVIPSSKQNLWDALYTALEKYHLVLTQRAKLLLE    631 - 700
NSSLEQQNTELQALLQQYLNSKINSELQVPPTQVLRVPTK                                  701 - 740
//

Text Mined References (9)

PMID Year Title
25411337 2015 Detailed structural and biochemical characterization of the nexin-dynein regulatory complex.
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
23354437 2013 The nexin-dynein regulatory complex subunit DRC1 is essential for motile cilia function in algae and humans.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12746204 Absence of nexin links as a possible cause of primary ciliary dyskinesia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.