Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.83
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96MB7 D3DQP9
Symbols C11orf77

Gene

  Ortholog (12)

Gene RIF (1)

PMID Text
18339812 The functions of two transposon-derived human proteins: HARBI1, a domesticated transposase-derived protein, and NAIF1, which contains a trihelix motif similar to that described in the Myb-like protein, was investigated.

AA Sequence

MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPE      1 - 70
TQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAG     71 - 140
MPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSS    141 - 210
QFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGA    211 - 280
LQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS     281 - 349
//

Text Mined References (8)

PMID Year Title
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
18339812 2008 Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15169610 2004 Harbinger transposons and an ancient HARBI1 gene derived from a transposase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.