Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.83
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18339812 The functions of two transposon-derived human proteins: HARBI1, a domesticated transposase-derived protein, and NAIF1, which contains a trihelix motif similar to that described in the Myb-like protein, was investigated.

AA Sequence

MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPE      1 - 70
TQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAG     71 - 140
MPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSS    141 - 210
QFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGA    211 - 280
LQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS     281 - 349
//

Text Mined References (8)

PMID Year Title
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
18339812 2008 Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15169610 2004 Harbinger transposons and an ancient HARBI1 gene derived from a transposase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.