Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.39
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.1e-04
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 2.9
Disease Target Count Z-score Confidence
Brachydactyly 156 4.155 2.1
Microcephaly 166 3.117 1.6

Expression

AA Sequence

MADKMVRTPKCSRCRNHGFLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALC      1 - 70
AQGPKQASGAAAAAPAPVPVPAASLRPLSPGTPSGDADPGPEGRAAACFFEQPPRGRNPGPRALQPVLGG     71 - 140
RSHVEPSERAAVAMPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPG    141 - 210
GSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQ    211 - 280
PQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD            281 - 342
//

Text Mined References (9)

PMID Year Title