Property Summary

NCBI Gene PubMed Count 32
PubMed Score 171.50
PubTator Score 27.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Leprosy 77
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.49901076528748E-12
nasopharyngeal carcinoma 1056 1.81106267968107E-8
lung adenocarcinoma 2714 3.14604453231684E-7
lung carcinoma 2844 3.16102371585079E-6
interstitial cystitis 2299 2.9961542694923E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.58335529330014E-4
psoriasis 6685 2.27226807041062E-4
cutaneous lupus erythematosus 1056 4.16472957725409E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.21046067429822E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.56828011488757E-4
medulloblastoma, large-cell 6234 7.2457357099421E-4
group 4 medulloblastoma 1875 8.78224854198083E-4
urothelial carcinoma 318 0.0141315250627078
chronic rhinosinusitis 512 0.0264062566570868
Disease Target Count Z-score Confidence
Parkinson's disease 364 3.455 1.7
Paratyphoid fever 10 3.183 1.6

Expression

Synonym

Accession Q96M98 E1P5B5 Q6IMB8 Q8IZM1 Q8NHP5 Q9H1V9
Symbols GLUP
PARK2CRG
HAK005771

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (25)

PMID Text
23861666 Mapping of the PARK2 and PACRG gene regulatory region with 96 SNPs, with a resolution of 1 SNP per 1 Kb for PARK2 gene regulatory region in a North Indian population, showed an involvement of 11 SNPs in determining the susceptibility towards leprosy.
23125027 PARK2 and PACRG are commonly downregulated in clear-cell renal cell carcinoma and are associated with aggressive disease and poor clinical outcome.
23052943 conducted high-density association mapping of PARK2/PACRG SNPs with leprosy and identified 69 SNPs significantly associated with leprosy in 198 single-case Vietnamese leprosy families
22652456 Elevated levels of PACRG result in increased neuronal autophagy.
22009144 single nucleotide polymorphisms of PARK2 with leprosy susceptibility in Chinese population
21816242 the association of polymorphisms rs9356058 and rs1040079 in gene PARK2/PACRG with leprosy
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20012177 PINK1, Omi/HtrA2 and parkin participate at different levels in mitochondrial quality control, converging through some overlapping and some distinct steps to maintain a common phenotype of healthy mitochondrial networks [REVIEW]
19723394 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT      1 - 70
AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN     71 - 140
KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSYSLP    141 - 210
RLECSGAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAF    211 - 280
INIKYVVPTYESCLLN                                                          281 - 296
//

Text Mined References (32)

PMID Year Title
23861666 2013 Mapping of PARK2 and PACRG overlapping regulatory region reveals LD structure and functional variants in association with leprosy in unrelated indian population groups.
23125027 2013 PARK2 and PACRG are commonly downregulated in clear-cell renal cell carcinoma and are associated with aggressive disease and poor clinical outcome.
23052943 2013 Linkage disequilibrium pattern and age-at-diagnosis are critical for replicating genetic associations across ethnic groups in leprosy.
22652456 2012 Parkin co-regulated gene is involved in aggresome formation and autophagy in response to proteasomal impairment.
22009144 2012 Association study of the single nucleotide polymorphisms of PARK2 and PACRG with leprosy susceptibility in Chinese population.
21816242 Leprosy epidemics during history increased protective allele frequency of PARK2/PACRG genes in the population of the Mljet Island, Croatia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20012177 2009 Mitochondrial quality control: insights on how Parkinson's disease related genes PINK1, parkin, and Omi/HtrA2 interact to maintain mitochondrial homeostasis.
More...