Property Summary

NCBI Gene PubMed Count 32
PubMed Score 173.21
PubTator Score 27.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
chronic rhinosinusitis -1.745 2.6e-02
cutaneous lupus erythematosus -1.300 4.2e-04
ependymoma 2.200 5.6e-10
group 4 medulloblastoma -1.500 8.8e-04
interstitial cystitis -1.700 6.3e-04
intraductal papillary-mucinous adenoma (... -1.300 4.2e-04
intraductal papillary-mucinous carcinoma... -1.500 1.6e-04
intraductal papillary-mucinous neoplasm ... -1.900 6.6e-04
lung adenocarcinoma -1.100 3.1e-07
lung carcinoma 1.700 3.2e-06
medulloblastoma, large-cell -1.900 7.2e-04
nasopharyngeal carcinoma -2.200 1.8e-08
psoriasis -1.500 2.3e-04
urothelial carcinoma -1.300 1.4e-02

Synonym

Accession Q96M98 E1P5B5 Q6IMB8 Q8IZM1 Q8NHP5 Q9H1V9
Symbols GLUP
PARK2CRG
HAK005771

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (25)

AA Sequence

MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT      1 - 70
AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN     71 - 140
KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSYSLP    141 - 210
RLECSGAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAF    211 - 280
INIKYVVPTYESCLLN                                                          281 - 296
//

Text Mined References (32)

PMID Year Title