Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Heroin dependence 30 4.482 2.2

Expression

AA Sequence

MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRME      1 - 70
TLNLRWEELGVKEAQLKAHIQKSEQFIQENDQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQ     71 - 140
RLSAKLKDYYIFNKYLEKVVENSEFEEIHEVIARYKTLVSMRHDLMQSAQEGQEKIERAKARLARYMEEK    141 - 210
DDEILQQNNELARLQMRFDRARSNVIFWESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHLKEVTEV    211 - 280
ALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI                                      281 - 316
//

Text Mined References (6)

PMID Year Title