Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.84
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23135275 KLHL15 can interact with the PP2A/B'beta heterotrimer, it only degrades B'beta, thus promoting exchange with other regulatory subunits.
14528312 KLHL15 (KIAA1677) binds Cul3

AA Sequence

MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQD      1 - 70
KIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFCCSFLLAKICLENCAEIMRLL     71 - 140
DDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKLMSYLDNDHLSRFPEIELYEAVQSWLRHDRR    141 - 210
RWRHTDTIIQNIRFCLMTPTSVFEKVKTSEFYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKP    211 - 280
QTTVFRGMIGHSMVNSKILLLKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVF    281 - 350
RYDPRQNSWLQMADMSVPRSEFAVGVIGKFIYAVAGRTRDETFYSTERYDITNDKWEFVDPYPVNKYGHE    351 - 420
GTVLNNKLFITGGITSSSTSKQVCVFDPSKEGTIEQRTRRTQVVTNCWENKSKMNYARCFHKMISYNGKL    421 - 490
YVFGGVCVILRASFESQGCPSTEVYNPETDQWTILASMPIGRSGHGVTVLDKQIMVLGGLCYNGHYSDSI    491 - 560
LTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEVRRCN                              561 - 604
//

Text Mined References (10)

PMID Year Title
27561354 2016 Cullin3-KLHL15 ubiquitin ligase mediates CtIP protein turnover to fine-tune DNA-end resection.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23135275 2012 Selective proteasomal degradation of the B'? subunit of protein phosphatase 2A by the E3 ubiquitin ligase adaptor Kelch-like 15.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15870933 2005 Identification and characterization of a novel kelch-like gene KLHL15 in silico.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14528312 2003 Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.