Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $65,745
PubMed Score 22.80
PubTator Score 5.09

Knowledge Summary

Patent

No data available

Gene RIF (8)

PMID Text
20553587 The KIAA1109-TENR-IL2-IL21 gene cluster, that encodes an interleukin (IL-21) that plays an important role in Th17 cell biology, is the 20th locus for which there is a genome-wide level of support for association with rheumatoid arthritis.
20553587 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19523143 Observational study of gene-disease association. (HuGE Navigator)
19302705 Using a family-based study, we have provided a trend for the association of the KIAA1109/Tenr/IL2/IL21 gene region with rheumatoid arthritis in populations of European descent
19302705 Observational study of gene-disease association. (HuGE Navigator)
17558408 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17558408 Genetic variation in a linkage disequilibrium block encompassing the KIAA1109-TENR-IL2-IL21 genes predisposes to celiac disease.

AA Sequence

MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLS      1 - 70
SISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYK     71 - 140
TGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKIS    141 - 210
QIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQDIKPDGRVLHDTHAVVTARRS    211 - 280
LLRYFYRQLLLFYSKNPAMMEKSIFCTEPTSNLLTLKQNINICLYMNQLPKGSAQIKSQLRLNPHSISAF    281 - 350
EANEELCLHVAVEGKIYLTVYCPKDGVNRISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISSILIGDGN    351 - 420
CSDTRGLEIAIKQRVDDALTSKLPMFYLVNRPHISLVPSAYPLQMNLEYKFLSLNWAQGDVSLEIVDGLS    421 - 490
GKITESSPFKSGMSMASRLCKAAMLSRFNLLAKEAKKELLEAGTYHAAKCMSASYQEAKCKLKSYLQQHG    491 - 560
YGSWIVKSPCIEQFNM                                                          561 - 576
//

Text Mined References (19)

PMID Year Title
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20553587 2010 Only one independent genetic association with rheumatoid arthritis within the KIAA1109-TENR-IL2-IL21 locus in Caucasian sample sets: confirmation of association of rs6822844 with rheumatoid arthritis at a genome-wide level of significance.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
19523143 2009 Multiple sclerosis association study with the TENR-IL2-IL21 region in a Spanish population.
19302705 2009 Testing for the association of the KIAA1109/Tenr/IL2/IL21 gene region with rheumatoid arthritis in a European family-based study.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
More...