Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.69
PubTator Score 5.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Heterotaxy, visceral, 6, autosomal 1 0.0 0.0
Disease Target Count
Situs ambiguous 8
Situs ambiguus 25
Disease Target Count P-value
osteosarcoma 7950 1.7e-08
nasopharyngeal carcinoma 1058 1.1e-04
ependymoma 4679 7.5e-04
chronic rhinosinusitis 512 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Right atrial isomerism 29 0.0 5.0
Disease Target Count Z-score Confidence
Visceral heterotaxy 14 0.0 4.0
Disease Target Count Z-score Confidence
Dextrocardia 12 3.928 2.0
Primary ciliary dyskinesia 76 3.322 1.7
Disease Target Count
Situs Inversus 65

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -2.017 3.2e-02
ependymoma 1.100 7.5e-04
nasopharyngeal carcinoma -1.400 1.1e-04
osteosarcoma -1.337 1.7e-08

Gene RIF (4)

AA Sequence

MYSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAILASIKSSERDRLKAEWDQHN      1 - 70
DCKILDSLVRARIKDAVQGFIINIEERRNKLRELLALEENEYFTEMQLKKETIEEKKDRMREKTKLLKEK     71 - 140
NEKERQDFVAEKLDQQFRERCEELRVELLSIHQKKVCEERKAQIAFNEELSRQKLVEEQMFSKLWEEDRL    141 - 210
AKEKREAQEARRQKELMENTRLGLNAQITSIKAQRQATQLLKEEEARLVESNNAQIKHENEQDMLKKQKA    211 - 280
KQETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRR    281 - 350
EEEKAQEKEFDRILEEDKAKKLAEKDKELRLEKEARRQLVDEVMCTRKLQVQEKLQREAKEQEERAMEQK    351 - 420
HINESLKELNCEEKENFARRQRLAQEYRKQLQMQIAYQQQSQEAEKEEKRREFEAGVAANKMCLDKVQEV    421 - 490
LSTHQVLPQNIHPMRKACPSKLPP                                                  491 - 514
//

Text Mined References (8)

PMID Year Title