Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 4.72775846055184E-7
posterior fossa group B ependymoma 1530 1.14041179850605E-6
medulloblastoma, large-cell 6234 1.40878438167197E-5
atypical teratoid / rhabdoid tumor 4369 8.12572005546636E-4
primitive neuroectodermal tumor 3031 0.00158394271902574

Expression

Synonym

Accession Q96M89 Q05DF1 Q4ZG07 Q53TE1 Q6ZUY5 Q86VL7
Symbols

Gene

  Ortholog (11)

 Compartment GO Term (2)

AA Sequence

MEPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPGDLDIYSGDKVGSSLKYSDE      1 - 70
SKHCRTPLGSLFKHVNVNCLDDELDSFHDLKKQETEEELIENDYRVSTSKITKQSFKEIEKVALPTNTTS     71 - 140
SRPRTECCSDAGDSPLKPVSCPKSKASDKRSLLPHQISQIYDELFQIHLKLQCETAAQQKFAEELQKRER    141 - 210
FLLEREQLLFRHENALSKIKGVEEEVLTRFQIIKEQHDAEVEHLTEVLKEKNKETKRLRSSFDALKELND    211 - 280
TLKKQLNEASEENRKIDIQAKRVQARLDNLQRKYEFMTIQRLKGSSHAVHEMKSLKQEKAPVSKTYKVPL    281 - 350
NGQVYELLTVFMDWISDHHLSKVKHEESGMDGKKPQLKFASQRNDIQEKCVKLLPLMTEQLQWMPFVNIK    351 - 420
LHEPFVKFIYWSLRQLDAGAQHSTMTSTLRRLGEDIFKGVVTKGIQDNSPQHSVENKPKTAAFFKSSNLP    421 - 490
LRFLSTLIVLKTVTQADYLAQAFDSLCLDLKTEEGKTLFLEYQAVPVILSHLRISSKGLLSNVIDSLLQM    491 - 560
TVESKSLQPFLEACSNSLFFRTCSVLLRAPKLDLQILEKLSIILQKLSKIKSNKKLFELFTIHLMLQEIQ    561 - 630
RTTNPEHAFLCINLNSTLFNLGLTKCNSLVSSASP                                       631 - 665
//

Text Mined References (5)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.