Knowledge Summary

Patent

No data available

Synonym

Accession Q96M85
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSHSRRAAPTQDQCHTPGFPTSRETSGSIWQARICGSLQALDTWRTHIPRKSPAPTQASQICLLLPESPW      1 - 70
RNPTPRGFLKPLINWDAILYFKEKRNIQVTTQAHPQNQASCSSQEVATPGLVPQAAAPKVYERSHDNLNA     71 - 140
EAQGLAGAQVSKPQNPITRLCSLKEQSILKIFTKQSI                                     141 - 177
//

Text Mined References (2)

PMID Year Title