Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.41
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.68714819859335E-17
medulloblastoma, large-cell 6234 1.04311634659369E-4
atypical teratoid / rhabdoid tumor 4369 3.63220031539141E-4
lung cancer 4473 0.0209136360906087

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma, large-cell 1.200 0.000
lung cancer -1.100 0.021
lung carcinoma 1.200 0.000

Synonym

Accession Q96M83 B0QZ71 Q08AN7 Q5VW55 Q8IVQ0 Q8N7T7 Q8NEQ0 Q9H943
Symbols BIOT2
BioT2-A
BioT2-B
BioT2-C
C10orf68

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG

Pathway (1)

Gene RIF (5)

PMID Text
22024937 A higher expression of hBiot2 in primary CRC patients independently indicates a poorer prognosis.
21109960 Overexpression of hBiot2 is associated with early and interim development of human cervical cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18984674 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKPVKHLLTTSNKSANVPALTTKKGLHNLPLSPELKEKHNAKLIHDKIEPMVLRSPPTGESILRYALPIP      1 - 70
SSKTKNLLPEDEMIGKIIKHLKMVVSTLEETYGHCDQNGEEPFVKHEHEELSLSVGDDMNSFLTYCSQFA     71 - 140
AQLEEALKEEQNILESLFKWFQWQVNQMEEISKDQTLLQAEPPKPDKTVILNIAEIVRLVQRFEELKNRL    141 - 210
KQRSKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLK    211 - 280
VFENQANMLERAVNDQVLLDAEYKQMQCDFQLLSEEKLVLENELQKLKDKEKTKPTNNRTKKAVKTVKKK    281 - 350
DKGKSEDSEKKMSPEKEFKIKEDLDQVQKVARLEIENKVLQEQLKQALQEAEKAKHQLNYFLNQEKLLKS    351 - 420
EGKTETTMQVGNSQTKVKGEDSKNIPLEKETRKSLVSDSGGQRTSDKIQEYPQITAQSGRLIEKSSEKKR    421 - 490
SSPAISDLSQILKSQDESAFLESSNEVSVAENQSYKSPSETHDKSLTTVSSSKEVQDSLSVGTLAQKNET    491 - 560
VISPFILPPVLTESKKADVSEEQLQKMTEEQTYQAAEKSQADSEVPDENLMVENKDSVTKVQIEQMKQRT    561 - 630
SSMERHEETLTTPQLPEDMVLVSRIQSETKNLKATRNESFHSHNDVPEENLMLEQDTKSKTEVEVKKQKS    631 - 700
FQDNQLSTHNEVPNERLVVEHQESLSKTKLQIKKQETSTEQPLTTPDKEPNENLILRHQDSMSKSEMQVK    701 - 770
EQRTLKGQRIITHDEEPGKNLVLEHQDSVSKLEMQIEKTKKLPREKRHSTHDEESGENPMLKHQDSVSKI    771 - 840
QVQLEIQETSEGEGRSIPDKNSMFVHQDSVSKLQMQEKKKITPGRERRNTRIVVPNENVISVHQDSKSKL    841 - 910
QMQEKKQINSGVERHKTFPLEIKKKDISLEHLLPEEKVLLSRSESQTKKLQAKVTSRKIKNEAASELPDT    911 - 980
AENLPAMYPSISDLIIQFDLNKVVETDIESLRGALGRRLLNDEFKTQSKSFPGPDIEQLTDAFGRDILKD    981 - 1050
EFKTRSKSLPETDERLHSTTERGTINDAIKTQLKRKSYPETVLKHLKGVNGKDIIKHLINIQSKSHGETD   1051 - 1120
KEHLADDTGRGIIKGSINAQLKGHQKTDKNFFAYATGRGLMKESTTTQLKSHPETDKEFLADAIGRGIII   1121 - 1190
GPITTQLKSHRETDKELLKDAIGRDIIKGPISAQLKSHQETDVEPLTNAIGSSKTIGEIKTQLRTHYDVN   1191 - 1260
LFKNKDMSVQRQEGIFTRSITPSKFPTKVINLSPFENKEETYEYSSPYVTAPSKAIYRTYRAGPSFSKDI   1261 - 1330
HLPLLNQLPSGHSKVVTLSQKTIEFTLPTVTNTVGKPTYKVLHAAARKSVPHPYF                  1331 - 1385
//

Text Mined References (13)

PMID Year Title
22024937 2012 Novel gene hBiot2 is an independent prognostic factor in colorectal cancer patients.
21109960 2011 Overexpression of the hBiot2 gene is associated with development of human cervical cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19277478 2009 RNA interference against Biot2, a novel mouse testis-specific gene, inhibits the growth of tumor cells.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...