Knowledge Summary

Patent

No data available

Synonym

Accession Q96M66
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MAAKSTQDSLPRDTGEPSALPVQGRAEGRSSEGRKERTAECALRGKQASEPALRKRNFLPGPNSDTVRPA      1 - 70
AETELVPCSLRHPRQDLCGEHPSFPVMQPSLETQAKPERDRAVLIPPKGPWPPAQGLAMRTHCPTGPPSK     71 - 140
AYCRGGSSSTSRNQVASLAYRTQNTAASQPRQPGGRGKEDTAGYGSCSPRSLAV                    141 - 194
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.