Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.41
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 7.4e-04
chronic rhinosinusitis -1.854 1.7e-02
ependymoma 2.400 7.7e-04
glioblastoma -1.100 9.3e-04
group 4 medulloblastoma -1.100 5.4e-03
medulloblastoma, large-cell -1.200 7.6e-05
nasopharyngeal carcinoma -2.800 2.7e-08
osteosarcoma -1.984 4.8e-08
psoriasis -2.000 6.0e-54

Gene RIF (4)

AA Sequence

MEGERRAYSKEVHQRINKQLEEIRRLEEVRGDLQVQISAAQNQVKRLRDSQRLENMDRLLKGRAQVQAEI      1 - 70
EELQEQTRALDKQIQEWETRIFTHSKNVRSPGFILDQKVKIRRRIRILENQLDRVTCHFDNQLVRNAALR     71 - 140
EELDLLRIDRNRYLNVDRKLKKEIHHLHHLVSTLILSSTSAYAVREEAKAKMGLLRERAEKEEAQSEMEA    141 - 210
QVLQRQILHLEQLHHFLKLKNNDRQPDPDVLEKREKQAGEVAEGVWKTSQERLVLCYEDALNKLSQLMGE    211 - 280
SDPDLLVQKYLEIEERNFAEFNFINEQNLELEHVQEEIKEMQEALVSARASKDDQHLLQEQQQKVLQQRM    281 - 350
DKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE    351 - 420
LLTVQAFLHAQSFTSLADAALLVLGQSLEDLPKKMAPLQPPDTLEDPPGFEASDDYPMSREELLSQVEKL    421 - 490
VELQEQAEAQRQKDLAAAAAKLDGTLSVDLASTQRAGSSTVLVPTRHPHAIPGSILSHKTSRDRGSLGHV    491 - 560
TFGGLSSSTGHLPSHITHGDPNTGHVTFGSTSASSGGHVTFRPVSASSYLGSTGYVGSSRGGENTEGGVE    561 - 630
SGGTASDSSGGLGSSRDHVSSTGPASSTGPGSSTSKDSRG                                  631 - 670
//

Text Mined References (15)

PMID Year Title