Property Summary

NCBI Gene PubMed Count 11
PubMed Score 241.65
PubTator Score 11.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.46804192864365E-34
Disease Target Count
Hirschsprung disease 1 9

Synonym

Accession Q96M53 A4QPA8 B2RPQ2 Q5T4G2
Symbols SPATIAL
C10orf27

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (7)

PMID Text
20937703 Functional analysis of the orthologous mouse protein.
19918778 Functional analysis of the orthologous mouse protein.
18208870 C10orf27 is a candidate gene for multiple sclerosis susceptibility and pathogenesis
18208870 Observational study of gene-disease association. (HuGE Navigator)
17961552 Functional analysis of the orthologous mouse protein.
17196196 Functional analysis of the orthologous mouse protein.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATDVQLADYPLMSPKAELKLEKKSGRKPRSPRDSGPQKELVIPGIVDFERIRRALRTPKPQTPGTYCFG      1 - 70
RLSHHSFFSRHHPHPQHVTHIQDLTGKPVCVVRDFPAPLPESTVFSGCQMGIPTISVPIGDPQSNRNPQL     71 - 140
SSEAWKKELKELASRVAFLTKEDELKKKEKEQKEEPLREQGAKYSAETGRLIPASTRAVGRRRSHQGQQS    141 - 210
QSSSRHEGVQAFLLQDQELLVLELLCRILETDLLSAIQFWLLYAPPKEKDLALGLLQTAVAQLLPQPLVS    211 - 280
IPTEKLLSQLPEVHEPPQEKQEPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAE    281 - 350
S//

Text Mined References (12)

PMID Year Title
24029068 2013 Peptides presented by HLA class I molecules in the human thymus.
20937703 2010 Tbata modulates thymic stromal cell proliferation and thymus function.
19918778 2010 Spatial (Tbata) expression in mature medullary thymic epithelial cells.
18208870 2008 Evidence for association of chromosome 10 open reading frame (C10orf27) gene polymorphisms and multiple sclerosis.
17961552 2007 Neuronal distribution of spatial in the developing cerebellum and hippocampus and its somatodendritic association with the kinesin motor KIF17.
17196196 2007 Dynamic distribution of Spatial during mouse spermatogenesis and its interaction with the kinesin KIF17b.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...