Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96M42 D3DSJ3
Symbols PRED76
C21orf129

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MDGGSLRASPAAMDGGALEPAQQLSSLEGWTGQDRLLIPRWREARSLSWMQSPDLESSKCLTQGCCYPQA      1 - 70
WILACSAALLQALASSDLQGSLDRVNYSRGLGPRVRLFVFPDTVGSTRKSGSTGNICSVMLNVATGCVRI     71 - 140
EK                                                                        141 - 142
//

Text Mined References (4)

PMID Year Title