Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96M42 D3DSJ3
Symbols PRED76
C21orf129

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20494980 The C21orf129 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

MDGGSLRASPAAMDGGALEPAQQLSSLEGWTGQDRLLIPRWREARSLSWMQSPDLESSKCLTQGCCYPQA      1 - 70
WILACSAALLQALASSDLQGSLDRVNYSRGLGPRVRLFVFPDTVGSTRKSGSTGNICSVMLNVATGCVRI     71 - 140
EK                                                                        141 - 142
//

Text Mined References (4)

PMID Year Title
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.