Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 4.481 2.2
Cryptorchidism 296 3.642 1.8

Synonym

Accession Q96M34 A1L4B7
Symbols TSCPA

Gene

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MEEPPQEALAEPLKHESPAAPSSAGHTKGQEEDDQKNQAERKADNHTAHRIADQTALRVPSQAESSIFSQ      1 - 70
ATNGVAEQNGHSTPGQAGRRASNPADVSDLRADDQVNQTPSEQTKGKASSQANNVQHEQSDGQVSGLTEE     71 - 140
RTAEQTERRLPTQAERRTSGQIDGRLAMPSDQRGSRQTDHRMAGQSERRASEQMDRRMSGEAERRTSEQI    141 - 210
THRLSKLSERRPSVQIDSGSSVPSDQSPSVQIDSGSSVPSDQRPSVQIDRRMSGKVRRRSSEKTDYRLAG    211 - 280
LADPGTSEQTDLRLYGLVDHKTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLA    281 - 350
DRQANHKDQLSYYETRGQSEDRIFPQLGNSKEDKEADYRVQPCKFEDSQVDLNSKPSVEMETQNATTIPP    351 - 420
YNPVDARFTSNFQAKDQALFPRLPSISSKLNYTSSQEKTQAIVTKSDEFSEIDQGKGYHIRNQTYRRFPS    421 - 490
IVYEDPYQVSLQYMEKHHILQIFQQITENLVYEKPEDPLNFMLCQV                            491 - 536
//

Text Mined References (5)

PMID Year Title