Property Summary

NCBI Gene PubMed Count 11
PubMed Score 23.75
PubTator Score 12.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.517 0.000
posterior fossa group B ependymoma 4.400 0.000
medulloblastoma, large-cell 1.200 0.000
nasopharyngeal carcinoma -2.200 0.000
Endometriosis -1.286 0.016
ovarian cancer 1.300 0.000
psoriasis -1.200 0.000

Synonym

Accession Q96M32 Q8IYP6 AK 7
Symbols AK 7

Gene

AK7

PANTHER Protein Class (3)

Gene RIF (4)

PMID Text
22801010 AK7 may be involved in the development of Primary ciliary dyskinesia (PCD).
21080915 Both AK7 and full-length AK8 showed highest affinity for AMP with ATP as the phosphate donor, and proved to be more efficient in AMP phosphorylation as compared with the major cytosolic isoform AK1
20537283 expression is decreased in patients with primary ciliary dyskinesia and is correlated with ciliary beat frequency of nasal epithelium cellsepithelium
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAEEEETAALTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENKSAMLEASSTK      1 - 70
VKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNITESSQQMEEAIWAVSALSEEV     71 - 140
SHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRRRKSHPNFLDHINAEKMVLKFGKKARKFAAY    141 - 210
VVAAGLQYGAEGGMLHTFFKMAWLGEIPALPVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDE    211 - 280
SVHTLEDIVKCISKNTGPGKIQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVE    281 - 350
NINTILKEYKQSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE    351 - 420
GEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQA    421 - 490
KDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNY    491 - 560
RDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGEPRNYGLTDEEKAEEERKAAEERL    561 - 630
AREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECC    631 - 700
NVRPEDPVDFLAEYLFKNNPEAQ                                                   701 - 723
//

Text Mined References (11)

PMID Year Title
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
22801010 New adenylate kinase 7 (AK7) mutation in primary ciliary dyskinesia.
21080915 2011 The characterization of human adenylate kinases 7 and 8 demonstrates differences in kinetic parameters and structural organization among the family of adenylate kinase isoenzymes.
20537283 Role of adenylate kinase type 7 expression on cilia motility: possible link in primary ciliary dyskinesia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10215863 1999 Identification of a novel human adenylate kinase. cDNA cloning, expression analysis, chromosome localization and characterization of the recombinant protein.
More...