Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQPPLPPVRPSA      1 - 70
PLPFVPPPAVPSVPPLVTSMPPPVSPSTAAAFGNPPVSHFPPSTSAPNTLLPAPPSGPPISGFSVGSTYD     71 - 140
ITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSLAQGTGTTSAITFPEEQEDPRITRGQDEASA    141 - 210
GGIWGFIKGVAGNPMVKSVLDKTKHSVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEV    211 - 280
FGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLV    281 - 350
VEDPVHGIHLETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS    351 - 420
RRQMIYSAARAIAGMYKQRLPPRTV                                                 421 - 445
//

Text Mined References (12)

PMID Year Title