Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.13563096300393E-8
primitive neuroectodermal tumor 3031 1.61929413807122E-5
osteosarcoma 7933 1.7808411068228E-5
atypical teratoid / rhabdoid tumor 4369 2.85483571508286E-5
acute quadriplegic myopathy 1157 3.04948854073565E-5
medulloblastoma, large-cell 6234 4.03289935554348E-5
glioblastoma 5572 9.94710312485889E-5
pediatric high grade glioma 2712 1.65272868576921E-4
ovarian cancer 8492 2.93727925426478E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.93096191608694E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.86913666502912E-4
group 3 medulloblastoma 2254 0.00205041733391333
Breast cancer 3099 0.0354101371960353

Expression

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

AA Sequence

MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQPPLPPVRPSA      1 - 70
PLPFVPPPAVPSVPPLVTSMPPPVSPSTAAAFGNPPVSHFPPSTSAPNTLLPAPPSGPPISGFSVGSTYD     71 - 140
ITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSLAQGTGTTSAITFPEEQEDPRITRGQDEASA    141 - 210
GGIWGFIKGVAGNPMVKSVLDKTKHSVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEV    211 - 280
FGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLV    281 - 350
VEDPVHGIHLETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS    351 - 420
RRQMIYSAARAIAGMYKQRLPPRTV                                                 421 - 445
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15541471 2005 Structural analysis and expression profile of a novel gene on chromosome 5q23 encoding a Golgi-associated protein with six splice variants, and involved within the 5q deletion of a Ph(-) CML patient.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...