Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MLPFFSNTTSKSVSVSSFQGSPATPLSFLFFFFLCRAGSSMTGCFTFFLDFIFFFAGVLGPSPMGMYSGA      1 - 70
STLTGFFLLRFLGQLSMDLEGLEWLGRASPSWWIFFSSSPSHRVPWGSCASASAPRLPVPHPPSPLSKCP     71 - 140
QHPRPRRTKGPGLRKLWGPGPPFFPS                                                141 - 166
//

Text Mined References (6)

PMID Year Title