Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96M19
Symbols FAM191B
C12orf67

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20639392 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPFFSNTTSKSVSVSSFQGSPATPLSFLFFFFLCRAGSSMTGCFTFFLDFIFFFAGVLGPSPMGMYSGA      1 - 70
STLTGFFLLRFLGQLSMDLEGLEWLGRASPSWWIFFSSSPSHRVPWGSCASASAPRLPVPHPPSPLSKCP     71 - 140
QHPRPRRTKGPGLRKLWGPGPPFFPS                                                141 - 166
//

Text Mined References (6)

PMID Year Title
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
20639392 2010 Genome-wide association analysis identifies multiple loci related to resting heart rate.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.