Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96M15
Symbols C3orf65

 Compartment GO Term (0)

AA Sequence

MATPLDNCLRPFPDPMVKVTAETKKISEVSSYVSANNKKNSFWGSGLLYPVALLRCQDCWAGHQTHVLSK      1 - 70
EFTSYFSSGAGREAQHQPSAVLGSLIWLRRVYLLRAMVVHGGSQPCQRWLVIRMEVGGHPSFPGHAWLTF     71 - 140
HLN                                                                       141 - 143
//

Text Mined References (3)

PMID Year Title