Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lung squamous cell carcinoma 10 3.822 1.9

Synonym

Accession Q96M15
Symbols C3orf65

 Compartment GO Term (0)

AA Sequence

MATPLDNCLRPFPDPMVKVTAETKKISEVSSYVSANNKKNSFWGSGLLYPVALLRCQDCWAGHQTHVLSK      1 - 70
EFTSYFSSGAGREAQHQPSAVLGSLIWLRRVYLLRAMVVHGGSQPCQRWLVIRMEVGGHPSFPGHAWLTF     71 - 140
HLN                                                                       141 - 143
//

Text Mined References (3)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.