Property Summary

NCBI Gene PubMed Count 13
PubMed Score 329.33
PubTator Score 8.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.031 6.1e-03
astrocytic glioma -2.100 4.7e-03
Breast cancer 1.100 1.2e-11
ependymoma -2.000 1.6e-02
glioblastoma -1.300 1.1e-03
intraductal papillary-mucinous carcinoma... 1.100 8.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-02
non-small cell lung cancer 1.090 3.9e-12
oligodendroglioma -2.100 7.4e-03
pediatric high grade glioma -1.100 7.6e-04
subependymal giant cell astrocytoma -1.363 9.0e-03

Gene RIF (3)

AA Sequence

MEELLPDGQIWANMDPEERMLAAATAFTHICAGQGEGDVRREAQSIQYDPYSKASVAPGKRPALPVQLQY      1 - 70
PHVESNVPSETVSEASQRLRKPVMKRKVLRRKPDGEVLVTDESIISESESGTENDQDLWDLRQRLMNVQF     71 - 140
QEDKESSFDVSQKFNLPHEYQGISQDQLICSLQREGMGSPAYEQDLIVASRPKSFILPKLDQLSRNRGKT    141 - 210
DRVARYFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYLVPTEKKRSALRWGVR    211 - 280
CDLANGVIPRKLPFPLSPS                                                       281 - 299
//

Text Mined References (16)

PMID Year Title