Property Summary

NCBI Gene PubMed Count 11
Grant Count 29
R01 Count 20
Funding $3,033,190.95
PubMed Score 519.75
PubTator Score 374.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.500 0.027
osteosarcoma 1.212 0.000
group 3 medulloblastoma -1.700 0.030
atypical teratoid/rhabdoid tumor -1.500 0.000
Breast cancer -1.300 0.000

Gene RIF (4)

PMID Text
26223354 Data identified a genetic variant in the FATS gene (905C > T, 262D/N) that is associated with susceptibility to breast cancer in a parity-dependent manner.
24240685 FATS is an E2-independent ubiquitin ligase that stabilizes p53 and promotes its activation in response to DNA damage.
22040499 FATS is involved in the carcinogenesis and development of breast cancer and could be a potential biomarker and prognostic factor for breast cancer therapy.
20844083 data suggest centrosomal functions for C10orf90 and KIAA1731 and new centriole-related functions for ALMS1

AA Sequence

MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASL      1 - 70
PLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASI     71 - 140
TITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVP    141 - 210
EAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQI    211 - 280
ASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSL    281 - 350
RRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF    351 - 420
SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPL    421 - 490
QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAPRDGAGSPGLSEDCS    491 - 560
ESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPHP    561 - 630
LSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV     631 - 699
//

Text Mined References (11)

PMID Year Title
26223354 2015 A functional genetic variant in fragile-site gene FATS modulates the risk of breast cancer in triparous women.
24240685 2014 FATS is an E2-independent ubiquitin ligase that stabilizes p53 and promotes its activation in response to DNA damage.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22040499 2011 Expression level of novel tumor suppressor gene FATS is associated with the outcome of node positive breast cancer.
20844083 2010 Centriolar association of ALMS1 and likely centrosomal functions of the ALMS motif-containing proteins C10orf90 and KIAA1731.
20843368 2010 FATS is a transcriptional target of p53 and associated with antitumor activity.
20154723 2010 An HDAC1-binding domain within FATS bridges p21 turnover to radiation-induced tumorigenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...