Property Summary

NCBI Gene PubMed Count 12
PubMed Score 547.39
PubTator Score 374.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 3.6e-19
osteosarcoma 7950 2.2e-05
atypical teratoid/rhabdoid tumor 357 6.8e-05
ependymoma 4679 2.7e-02
group 3 medulloblastoma 4104 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Atherosclerosis 291 3.466 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.500 6.8e-05
Breast cancer -1.300 3.6e-19
ependymoma -1.500 2.7e-02
group 3 medulloblastoma -1.700 3.0e-02
osteosarcoma 1.212 2.2e-05

Gene RIF (4)

AA Sequence

MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASL      1 - 70
PLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASI     71 - 140
TITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVP    141 - 210
EAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQI    211 - 280
ASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSL    281 - 350
RRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF    351 - 420
SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPL    421 - 490
QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAPRDGAGSPGLSEDCS    491 - 560
ESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPHP    561 - 630
LSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV     631 - 699
//

Text Mined References (12)

PMID Year Title