Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.02
PubTator Score 10.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
active ulcerative colitis -1.726 2.3e-02
adrenocortical carcinoma -1.571 8.1e-04
Amyotrophic lateral sclerosis 1.111 2.0e-07
Breast cancer -1.100 1.9e-09
non-small cell lung cancer -1.247 9.4e-17
osteosarcoma 2.031 2.4e-05
pancreatic ductal adenocarcinoma liver m... -1.631 1.1e-03
pituitary cancer 1.100 1.1e-04

Gene RIF (6)

AA Sequence

MPYSTNKELILGIMVGTAGISLLLLWYHKVRKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQE      1 - 70
RQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHRARKRRLPTIQSSATS     71 - 140
NSSEEAESEGGYITANTDTEEQSFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKF    141 - 210
RDEIEFMWRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQN    211 - 280
KINYGHLFKEHLDIAIKLLPEEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAE    281 - 350
ELCPGYSNPNYMYLAKCYTDLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR              351 - 410
//

Text Mined References (15)

PMID Year Title