Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.02
PubTator Score 10.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 2.031 0.000
Amyotrophic Lateral Sclerosis 1.111 0.000
adrenocortical carcinoma -1.571 0.001
pancreatic ductal adenocarcinoma liver m... -1.631 0.001
non-small cell lung cancer -1.247 0.000
ulcerative colitis -2.300 0.000
Breast cancer -1.100 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q96LZ7 A9UMZ7 A9UN00 Q4ZG33 Q6UXN4 Q8N657 Q8N9A2 Q8NCV6 Q8NHM0 RMD-2
Symbols RMD2
RMD4
RMD-2
FAM82A
BLOCK18
FAM82A1
PRO34163
PYST9371

Gene

Gene RIF (6)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPYSTNKELILGIMVGTAGISLLLLWYHKVRKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQE      1 - 70
RQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHRARKRRLPTIQSSATS     71 - 140
NSSEEAESEGGYITANTDTEEQSFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKF    141 - 210
RDEIEFMWRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQN    211 - 280
KINYGHLFKEHLDIAIKLLPEEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAE    281 - 350
ELCPGYSNPNYMYLAKCYTDLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR              351 - 410
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18070910 2007 RMD-1, a novel microtubule-associated protein, functions in chromosome segregation in Caenorhabditis elegans.
More...