Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.89
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.075 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.012
lung adenocarcinoma -1.100 0.000

AA Sequence

MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPEINQQLSLESM      1 - 70
ELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLLVTIENHTPLVELSEYLGTNT     71 - 140
LSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSGEKKHKCGDCGKIFNHRANLRTHRRIHTGEK    141 - 210
PYKCAKCSASFRQHSHLSRHMNSHVKEKPYTCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEK    211 - 280
PNLALPEETFVSGPQYQHTKCMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTF    281 - 350
PCFSELISHQNIHTEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI    351 - 420
KNTT                                                                      421 - 424
//

Text Mined References (8)

PMID Year Title
21593219 2011 Methylation screening of reciprocal genome-wide UPDs identifies novel human-specific imprinted genes.
21324877 2011 A novel approach identifies new differentially methylated regions (DMRs) associated with imprinted genes.
19968752 2010 Molecular characterization and gene disruption of a novel zinc-finger protein, HIT-4, expressed in rodent brain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16467561 2006 Analysis of allelic differential expression in human white blood cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.