Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.40
PubTator Score 4.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.14647440524152E-7
pituitary cancer 1972 1.98930866706623E-5
cystic fibrosis 1670 2.78519212562404E-5
ovarian cancer 8492 3.84532927470753E-5
lung cancer 4473 7.34920116367174E-5
colon cancer 1475 0.00455841973370232
astrocytic glioma 2241 0.0173288988443726
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
astrocytic glioma -1.400 0.017
lung cancer 2.000 0.000
colon cancer -1.300 0.005
cystic fibrosis -1.700 0.000
ovarian cancer -1.600 0.000
pituitary cancer -1.200 0.000

Synonym

Accession Q96LW9 Q6P178 Q8WWS5
Symbols ZNF323
ZNF310P
ZNF20-Lp

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

 GWAS Trait (1)

Gene RIF (2)

PMID Text
25759474 ZNF323 is a schizophrenia susceptibility gene whose expression may influence schizophrenia risk.
12147252 role in early human embryonic development

AA Sequence

MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRLRELCHQWLRP      1 - 70
EIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLL     71 - 140
EDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDV    141 - 210
SLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRS    211 - 280
SLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKR    281 - 350
YQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP                  351 - 406
//

Text Mined References (13)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25759474 2015 Systematic Integration of Brain eQTL and GWAS Identifies ZNF323 as a Novel Schizophrenia Risk Gene and Suggests Recent Positive Selection Based on Compensatory Advantage on Pulmonary Function.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24888570 2014 Replication and cross-phenotype study based upon schizophrenia GWASs data in the Japanese population: support for association of MHC region with psychosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...