Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.51
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.100 0.036
medulloblastoma, large-cell -1.600 0.000
adult high grade glioma -1.100 0.001
group 4 medulloblastoma -1.300 0.001
ovarian cancer 1.100 0.000

Synonym

Accession Q96LW7 Q5BJH8 Q9BSY2
Symbols BinCARD
C9orf89

Gene

PDB

4DWN   4FH0  

 GO Function (1)

Gene RIF (2)

PMID Text
23633586 the crystal structure of BinCARD reveals that all three cysteines were oxidized
15637807 BinCard inhibits BCL10-mediated activation of NF-kappa B.

AA Sequence

MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQ      1 - 70
RSGERDCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPG     71 - 140
LASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRG    141 - 210
SLHVCVDSNLVPTAAWRS                                                        211 - 228
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23633586 2013 The structure of the caspase recruitment domain of BinCARD reveals that all three cysteines can be oxidized.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15637807 2004 Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.