Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
Funding $1,188,659.5
PubMed Score 29.88
PubTator Score 21.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96LW4 D3DP55 D6RDM1 Q5HYJ9 hPrimpol1
Symbols MYP22
CCDC111
Primpol1

Gene

 Grant Application (2)

Gene RIF (15)

PMID Text
26984527 findings establish that PolDIP2 can regulate the translesion synthesis polymerase and primer extension activities of PrimPol
26710848 Data suggest that, during genetic transcription, Prim-Pol-alpha-cat binds the DNA/RNA junction at 5prime-terminus of RNA primer (or initiating NTP, nucleoside-triphosphate).
26627254 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation
26626482 Implicate PrimPol in promoting restart of DNA synthesis downstream of, but closely coupled to, G4 replication impediments.
26552983 The molecular mechanism of polymerization and nucleoside reverse transcriptase inhibitor incorporation by human PrimPol have been described.
25746449 PrimPol tolerates DNA lesions, involving template and primer dislocations that can be operating during both mitochondrial and nuclear DNA replication. PrimPol could also operate as a translesion synthesis partner during DNA-directed RNA synthesis.
25550423 The authors propose a mechanism whereby single-stranded DNA binding proteins greatly restrict the contribution of PrimPol to DNA replication at stalled forks, thus reducing the mutagenic potential of PrimPol during genome replication.
25262353 The data establishes that a point mutation identified in PrimPol from patients with high myopia results in a major disruption of the catalytic and replication activities associated with human PrimPol thus establishing a link between replication stress and high myopia.
25255211 Data suggest that PrimPol exhibits fidelity that is 1.7-fold more accurate with magnesium as cofactor compared to manganese; activity of PrimPol is increased 400-1000-fold by manganese compared to magnesium based on steady-state kinetic parameters.
24682820 Although PrimPol's primase activity is required to restore wild-type replication fork rates in irradiated PrimPol-/- cells, the polymerase activity is sufficient to maintain regular replisome progression in unperturbed cells.
More...

AA Sequence

MNRKWEAKLKQIEERASHYERKPLSSVYRPRLSKPEEPPSIWRLFHRQAQAFNFVKSCKEDVHVFALECK      1 - 70
VGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCK     71 - 140
ALQELYGVNCSAEDVLNLDSSTDEKFSQHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPE    141 - 210
TTGHGFPHFSEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFVD    211 - 280
LGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQ    281 - 350
NKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCE    351 - 420
NIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSN    421 - 490
ETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE    491 - 560
//

Text Mined References (25)

PMID Year Title
26984527 2016 PolDIP2 interacts with human PrimPol and enhances its DNA polymerase activities.
26710848 2016 Insight into the Human DNA Primase Interaction with Template-Primer.
26627254 2015 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation.
26626482 2016 PrimPol Is Required for Replicative Tolerance of G Quadruplexes in Vertebrate Cells.
26552983 2015 Insights into the Molecular Mechanism of Polymerization and Nucleoside Reverse Transcriptase Inhibitor Incorporation by Human PrimPol.
25746449 2015 Alternative solutions and new scenarios for translesion DNA synthesis by human PrimPol.
25550423 2015 Human PrimPol is a highly error-prone polymerase regulated by single-stranded DNA binding proteins.
25262353 2014 Human PrimPol mutation associated with high myopia has a DNA replication defect.
25255211 2014 Kinetic analysis of human PrimPol DNA polymerase activity reveals a generally error-prone enzyme capable of accurately bypassing 7,8-dihydro-8-oxo-2'-deoxyguanosine.
24682820 2014 Molecular dissection of the domain architecture and catalytic activities of human PrimPol.
More...