Property Summary

NCBI Gene PubMed Count 24
PubMed Score 40.88
PubTator Score 21.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
MYOPIA 22, AUTOSOMAL DOMINANT 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Myopia 176 3.457 1.7

Expression

  Differential Expression (6)

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (18)

AA Sequence

MNRKWEAKLKQIEERASHYERKPLSSVYRPRLSKPEEPPSIWRLFHRQAQAFNFVKSCKEDVHVFALECK      1 - 70
VGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCK     71 - 140
ALQELYGVNCSAEDVLNLDSSTDEKFSQHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPE    141 - 210
TTGHGFPHFSEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFVD    211 - 280
LGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQ    281 - 350
NKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCE    351 - 420
NIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSN    421 - 490
ETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE    491 - 560
//

Text Mined References (28)

PMID Year Title