Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.01
PubTator Score 3.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q96LU5 D3DQZ7 Q96SH9
Symbols IMP1
IMMP1
IMP1-LIKE

Gene

PANTHER Protein Class (3)

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVI      1 - 70
AKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGR     71 - 140
IFFKIWPLSDFGFLRASPNGHRFSDD                                                141 - 166
//

Text Mined References (8)

PMID Year Title
25027321 2014 Genome-wide association and admixture analysis of glaucoma in the Women's Health Initiative.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15814844 2005 Mature DIABLO/Smac is produced by the IMP protease complex on the mitochondrial inner membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.