Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.12
PubTator Score 135.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (2)

AA Sequence

MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTAFA      1 - 70
TFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDRVHSPCPTSGSEKKKRSDDPVEDDKEKKELGYLTVE     71 - 140
NGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVPKFYVQVLHLMNKMNLPTPFGPITARPPMYE    141 - 210
DYMPLHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELANLQPKRPKTIKQRHVR    211 - 280
KKRKIKDMLNTPLCPSHSSLHPVLLPSDVFDQPQPVGNKRIEFHISTDMPAAFKKDLEKEQNCEEKNHDL    281 - 350
PATEVDASNIGFGKIFPKPNLDITEEIKEDSDEMPSECISRRELEKGRISREEMETLSVFRSYEPGEPNC    351 - 420
RIYVKNLAKHVQEKDLKYIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFIGLPNEKAAAKALKEANGYV    421 - 490
LFGKPMVVQFARSARPKQDPKEGKRKC                                               491 - 517
//

Text Mined References (17)

PMID Year Title