Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.14
PubTator Score 135.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96LT9 A8K1C9 D3DT74 Q5TZ87 Q96FK7 Q96JI8 Q9NSU7 Q9NXX2
Symbols RNP
RBM40
SNRNP65

Gene

PDB

3EGN  

Gene RIF (2)

PMID Text
24480542 Exome analysis of one proband revealed missense (c.1320C>A, p.P474T) and nonsense (c.1504C>T, p.R502X) mutations in the RNPC3 gene.
16096647 U11/U12-65K contribute to di-snRNP formation and intron bridging in the minor prespliceosome

AA Sequence

MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTAFA      1 - 70
TFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDRVHSPCPTSGSEKKKRSDDPVEDDKEKKELGYLTVE     71 - 140
NGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVPKFYVQVLHLMNKMNLPTPFGPITARPPMYE    141 - 210
DYMPLHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELANLQPKRPKTIKQRHVR    211 - 280
KKRKIKDMLNTPLCPSHSSLHPVLLPSDVFDQPQPVGNKRIEFHISTDMPAAFKKDLEKEQNCEEKNHDL    281 - 350
PATEVDASNIGFGKIFPKPNLDITEEIKEDSDEMPSECISRRELEKGRISREEMETLSVFRSYEPGEPNC    351 - 420
RIYVKNLAKHVQEKDLKYIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFIGLPNEKAAAKALKEANGYV    421 - 490
LFGKPMVVQFARSARPKQDPKEGKRKC                                               491 - 517
//

Text Mined References (17)

PMID Year Title
24480542 2014 Defective minor spliceosome mRNA processing results in isolated familial growth hormone deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19447915 2009 Functional stabilization of an RNA recognition motif by a noncanonical N-terminal expansion.
18559850 2008 Minor spliceosome components are predominantly localized in the nucleus.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16096647 2005 The U11/U12 snRNP 65K protein acts as a molecular bridge, binding the U12 snRNA and U11-59K protein.
More...