Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.2e-11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Van der Woude syndrome 9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.170 1.2e-11

AA Sequence

MLLLDLMSSPSPQLLVAAAQQTLGMGKRRSPPQAICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYL      1 - 70
EELKGLGFLTFGLHILEIGENSLIVSPEHVCQHLEQVLLGTIAFVDVSSCQRHPSVCSLDQLQDLKALVA     71 - 140
EIITHLQGLQRDLSLAVSYSRLHSSDWNLCTVFGILLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWL    141 - 210
LGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADLSISSEIVTLPAVAL               211 - 269
//

Text Mined References (5)

PMID Year Title