Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 17.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.089 3.1e-03
adult high grade glioma -1.300 1.2e-04
breast carcinoma -1.900 5.2e-05
Down syndrome 1.900 2.8e-03
fibroadenoma -2.500 6.1e-03
gastric carcinoma 1.700 1.3e-02
group 4 medulloblastoma -1.100 3.7e-03
inflammatory breast cancer -1.400 2.7e-04
interstitial cystitis 1.800 6.3e-04
intraductal papillary-mucinous adenoma (... -3.200 2.2e-05
intraductal papillary-mucinous carcinoma... -3.300 5.4e-05
intraductal papillary-mucinous neoplasm ... -3.000 1.4e-03
lung adenocarcinoma -2.100 3.6e-11
lung cancer -3.200 1.1e-05
medulloblastoma, large-cell -1.900 1.1e-05
non-small cell lung cancer -1.989 5.9e-14
ovarian cancer 1.800 9.1e-10
psoriasis -2.000 9.7e-07
ulcerative colitis 1.400 3.9e-03

 GO Function (1)

Gene RIF (2)

AA Sequence

MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLR      1 - 70
EVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSL     71 - 140
IFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFL    141 - 210
IPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF     211 - 279
//

Text Mined References (12)

PMID Year Title