Property Summary

NCBI Gene PubMed Count 34
PubMed Score 21.84
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia 2.200 4.5e-02
acute quadriplegic myopathy 1.712 4.5e-08
astrocytic glioma -1.300 2.5e-02
atypical teratoid / rhabdoid tumor -2.200 2.0e-05
Breast cancer -1.300 2.9e-04
ependymoma -1.300 1.8e-04
glioblastoma -1.200 4.4e-04
group 3 medulloblastoma -2.100 9.1e-03
intraductal papillary-mucinous adenoma (... -1.900 6.5e-05
intraductal papillary-mucinous carcinoma... -2.000 7.8e-04
intraductal papillary-mucinous neoplasm ... -1.400 3.2e-02
invasive ductal carcinoma -1.100 3.4e-02
medulloblastoma, large-cell -1.600 9.6e-03
ovarian cancer -1.300 8.7e-05
pancreatic cancer 1.300 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.032 1.3e-02
pituitary cancer -1.600 1.2e-03
primitive neuroectodermal tumor -1.400 1.2e-02
tuberculosis 1.100 4.5e-07
ulcerative colitis 1.100 6.8e-03

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD      1 - 70
PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICL     71 - 140
DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT             141 - 201
//

Text Mined References (44)

PMID Year Title