Property Summary

NCBI Gene PubMed Count 29
Grant Count 7
R01 Count 7
Funding $407,698.4
PubMed Score 21.27
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26020062 rs7612463 UBE2E2 single nucleotide polymorphism is associated with type 2 diabetes mellitus in a Chinese Han population.
25337779 Study found lack of association between UBE2E2 gene polymorphism (rs7612463) and type 2 diabetes mellitus in a Saudi population
23862583 The genetic variants of UBE2E2 are associated with gestational diabetes mellitus and fasting blood glucose.
20818381 Single nucleotide polymorphism in UBE2E2 is associated with type 2 diabetes.
20818381 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
15545318 Ubiquitin charging can function as a nuclear import trigger, and identify a novel link between E2 regulation and karyopherin-mediated transport.
15485925 Ubc8 is a major ISG15-conjugating enzyme responsible for protein ISGylation upon interferon stimulation
11786535 Siah proteins function as E3 ubiquitin-protein ligases

AA Sequence

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD      1 - 70
PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICL     71 - 140
DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT             141 - 201
//

Text Mined References (38)

PMID Year Title
26020062 2015 Association between UBE2E2 variant rs7612463 and type 2 diabetes mellitus in a Chinese Han population.
25416956 2014 A proteome-scale map of the human interactome network.
25337779 2014 Lack of association between UBE2E2 gene polymorphism (rs7612463) and type 2 diabetes mellitus in a Saudi population.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132900 2013 Genome-wide association study of atypical psychosis.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23862583 2013 Putative association between UBE2E2 polymorphisms and the risk of gestational diabetes mellitus.
More...