Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.48
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 0.027
ependymoma -1.400 0.000
oligodendroglioma -1.200 0.029
glioblastoma -1.200 0.000
pediatric high grade glioma -1.200 0.003
pilocytic astrocytoma -1.400 0.000
sonic hedgehog group medulloblastoma -1.200 0.013
aldosterone-producing adenoma 2.236 0.007
lung carcinoma 1.100 0.000

Gene RIF (6)

PMID Text
26317579 among high risk HPV-positive women from an outpatient population aged >/= 30 years, methylation analysis of FAM19A4 is an attractive marker for the identification of women with high-grade cervical intraepithelial neoplasia and cervical cancer
25281488 High methylation of FAM19A4 is associated with cervical carcinomas.
25109685 FAM19A4 is a novel ligand of formyl peptide receptor 1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEER      1 - 70
SQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR     71 - 140
//

Text Mined References (13)

PMID Year Title
26317579 2016 Comparing the performance of FAM19A4 methylation analysis, cytology and HPV16/18 genotyping for the detection of cervical (pre)cancer in high-risk HPV-positive women of a gynecologic outpatient population (COMETH study).
25416956 2014 A proteome-scale map of the human interactome network.
25281488 2014 Methylation analysis of the FAM19A4 gene in cervical scrapes is highly efficient in detecting cervical carcinomas and advanced CIN2/3 lesions.
25109685 2015 FAM19A4 is a novel cytokine ligand of formyl peptide receptor 1 (FPR1) and is able to promote the migration and phagocytosis of macrophages.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...