Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.61
PubTator Score 2.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.230 0.000

Gene RIF (1)

PMID Text
21048106 C1orf190 can activate NF-kappaB, drive production of cytokines, and promote the antigen-presenting function and priming ability of dendritic cells.

AA Sequence

MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLR      1 - 70
AIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLD     71 - 140
SVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGP    141 - 210
PESPEDESAKLGFEAHWFWEQCQDDVTFL                                             211 - 239
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21048106 2010 Chromosome 1 open reading frame 190 promotes activation of NF-?B canonical pathway and resistance of dendritic cells to tumor-associated inhibition in vitro.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18854160 2008 A tripartite complex containing MRCK modulates lamellar actomyosin retrograde flow.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.