Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.39
PubTator Score 2.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.4e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.230 9.4e-06

Synonym

Accession Q96LR2
Symbols LRP35A
LRAP35a
C1orf190

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLR      1 - 70
AIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLD     71 - 140
SVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGP    141 - 210
PESPEDESAKLGFEAHWFWEQCQDDVTFL                                             211 - 239
//

Text Mined References (10)

PMID Year Title